84-5380-76　［取扱停止］SDHD 200ul　531682

特徴

• This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate.
• The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane.
• Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma.
• Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted.
• There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18.
• Alternative splicing results in multiple transcript variants.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:HLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGIC
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.