84-5379-53　［取扱停止］RPS6KA2 50ul　531642

特徴

• This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases.
• This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway.
• The activity of this protein has been implicated in controlling cell growth and differentiation.
• Alternative splice variants, encoding different isoforms, have been characterized.
• Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:100-1:200Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:ALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
• Positive Control:HeLa, A-549, U-87MG, PC-12, Mouse brian, Mouse heart, Rat brain
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.