84-5379-41　［取扱停止］RPS23 50ul　531638

特徴

• Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit.
• Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
• This gene encodes a ribosomal protein that is a component of the 40S subunit.
• The protein belongs to the S12P family of ribosomal proteins.
• It is located in the cytoplasm.
• The protein shares significant amino acid similarity with S.
• cerevisiae ribosomal protein S28.
• As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• [provided by RefSeq, Jul 2008]
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:PFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRF
• Positive Control:Raji, U-87MG
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.