84-5378-95　［取扱停止］RPL26 50ul　531623

特徴

• Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit.
• Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
• This gene encodes a ribosomal protein that is a component of the 60S subunit.
• The protein belongs to the L24P family of ribosomal proteins.
• It is located in the cytoplasm.
• As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Mutations in this gene result in Diamond-Blackfan anemia.
• Alternative splicing results in multiple transcript variants.
• Applications:Suitable for use in Western Blot and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:NAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTV
• Positive Control:K562, HT-29, HeLa, mouse liver, mouse kidney, mouse brain, rat thymus, rat spleen, rat lung
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.