84-5377-29　［取扱停止］RBPMS 50ul　531568

特徴

• This gene encodes a member of the RNA recognition motif family of RNA-binding proteins.
• The RNA recognition motif is between 80-100 amino acids in length and family members contain one to four copies of the motif.
• The RNA recognition motif consists of two short stretches of conserved sequence, as well as a few highly conserved hydrophobic residues.
• The encoded protein has a single, putative RNA recognition motif in its N-terminus.
• Alternative splicing results in multiple transcript variants encoding different isoforms.
• Applications:Suitable for use in Western Blot and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:200-1:2000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:LVGTPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.