This gene encodes a member of the U2AF65 family of proteins.
The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins.
It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel.
Multiple transcript variants have been observed for this gene.
A related pseudogene has been identified on chromosome X.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000mmunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human RBM39. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide corresponding to a sequence within 400aa to the C-terminus of human RBM39 (NP_001229528.1).
