84-5376-49　［取扱停止］RAD54B 200ul　531541

特徴

• The protein encoded by this gene belongs to the DEAD-like helicase superfamily.
• It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA.
• This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.
• This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination.
• Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.
• Applications:Suitable for use in Western Blot, Immunofluorescence and Immunoprecipitation.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunoprecipitation: 1:50-1:100Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT
• Positive Control:HeLa, Jurkat, DU145, HT-29, mouse testis
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.