The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family.
PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes.
PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif.
This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation.
This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity.
Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis.
Alternatively spliced transcript variants have been described.
Related pseudogenes exist on chromosomes 11, 12 and 17.
Applications:Suitable for use in Western Blot, Immunofluorescence and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:2000Immunohistochemistry: 1:50-1:200Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human PTP4A2. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IF IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa30-100 of human PTP4A2 (NP_536316.1).