The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family.
PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes.
PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif.
This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation.
This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity.
Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis.
Alternatively spliced transcript variants have been described.
Related pseudogenes exist on chromosomes 11, 12 and 17.
Applications:Suitable for use in Western Blot, Immunofluorescence and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:2000Immunohistochemistry: 1:50-1:200Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human PTP4A2. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IF IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Recombinant fusion protein containing a sequence corresponding to aa30-100 of human PTP4A2 (NP_536316.1).
