Premature ovarian failure (POF) is characterized by primary or secondary amenorrhea in women less than 40 years old.
Two POF susceptibility regions called "POF1" and "POF2" have been identified by breakpoint mapping of X-autosome translocations.
POF1 extends from Xq21-qter while POF2 extends from Xq13.3 to Xq21.1.
This gene, POF1B, resides in the POF2 region.
This gene is expressed at trace levels in mouse prenatal ovary and is barely detectable or absent from adult ovary, in human and in the mouse respectively.
This gene's expression is restricted to epithelia with its highest expression in the epidermis, and oro-pharyngeal and gastro-intestinal tracts.
The protein encoded by this gene binds non-muscle actin filaments.
The role this gene may play in the etiology of premature ovarian failure remains to be determined.
[provided by RefSeq, Jan 2010]
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:LVLSTFSNIREELGHLQNDMTSLENDKMRLEKDLSFKDTQLKEYEELLASVRANNHQQQQGLQDSSSKCQALEENNLSLRHTLSDMEYRLKELEYCKRNLEQENQNLRMQVSETCTGPMLQAKMDEIGNHYTEMVKNLRMEKDREICRLRSQLNQYHKDVSKREGSCSDFQFKLHELTSLLEEKDSLIKRQSEELSKLRQEIYSSHNQPSTGGRTTITTKKYRTQYPILGL
Positive Control:Rat kidney
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human POF1B. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa330-560 of human POF1B (NP_079197.3).