84-5372-16　［取扱停止］PIGM 200ul　531397

特徴

• This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis.
• The glycosylphosphatidylinositol (GPI)-anchor is a glycolipid which contains three mannose molecules in its core backbone.
• The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface.
• This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum.
• [provided by RefSeq, Jul 2008]
• Applications:Suitable for use in Western Blot and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK
• Positive Control:BxPC-3, mouse thymus, mouse spleen, mouse lung, rat thymus, rat spleen
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.