This gene encodes a protein which contains a zinc finger-like PHD (plant homeodomain) finger, distinct from other classes of zinc finger motifs, and a hydrophobic and highly conserved domain.
The PHD finger shows the typical Cys4-His-Cys3 arrangement.
PHD finger genes are thought to belong to a diverse group of transcriptional regulators possibly affecting eukaryotic gene expression by influencing chromatin structure.
Applications:Suitable for use in Immunofluorescence.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 1:50-1:100Optimal dilutions to be determined by the researcher.
AA Sequence:AKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSDDAPYSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：200ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human PHF2. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：IF
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to a sequence within aa850-950 of human PHF2 (NP_005383.3).
