This gene encodes a protein which contains a zinc finger-like PHD (plant homeodomain) finger, distinct from other classes of zinc finger motifs, and a hydrophobic and highly conserved domain.
The PHD finger shows the typical Cys4-His-Cys3 arrangement.
PHD finger genes are thought to belong to a diverse group of transcriptional regulators possibly affecting eukaryotic gene expression by influencing chromatin structure.
Applications:Suitable for use in Immunofluorescence.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 1:50-1:100Optimal dilutions to be determined by the researcher.
AA Sequence:AKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSDDAPYSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human PHF2. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:IF
Calc Crossreactivity:Hu Rt
Immunogen:Synthetic peptide corresponding to a sequence within aa850-950 of human PHF2 (NP_005383.3).