This gene encodes a protein involved in import of peroxisomal matrix proteins.
This protein localizes to the peroxisomal membrane.
Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.
Alternative splicing results in two transcript variants encoding different isoforms.
Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:100-1:200Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:EVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRAL
Positive Control:U-87MG, LO2
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human PEX10. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IF IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa10-160 of human PEX10 (NP_002608.1).