84-5370-08　［取扱停止］P70 S6K 50ul　531329

特徴

• This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases.
• The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation.
• Activity of this gene has been associated with human cancer.
• Alternatively spliced transcript variants have been observed.
• The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations.
• There are two pseudogenes for this gene on chromosome 17.
• Applications:Suitable for use in Western Blot and Immunohistochemistry.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
• Positive Control:HeLa, 293T, Jurkat, HepG2, NIH/3T3, Mouse lung, PC-12, rat brain
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.