84-5367-20　［取扱停止］NFATC4 50ul　531234

特徴

• This gene encodes a member of the nuclear factor of activated T cells (NFAT) protein family.
• The encoded protein is part of a DNA-binding transcription complex.
• This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor stimulation and an inducible nuclear component.
• NFAT proteins are activated by the calmodulin-dependent phosphatase, calcineurin.
• The encoded protein plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of interleukin-2 and interleukin-4.
• Alternative splicing results in multiple transcript variants.
• [provided by RefSeq, Jan 2014]
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:QGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFG
• Positive Control:SKOV3, HepG2, A-549, Mouse lung, Mouse kidney, Mouse brain
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.