This gene is part of a 500 kb inverted duplication on chromosome 5q13.
This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions.
The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region.
This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13.
It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1.
The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals.
Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:LLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVV
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human NAIP. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to a sequence within aa750-850 of human NAIP (NP_075043.1).
