84-5365-63　［取扱停止］MUC20 100ul　531182

特徴

• This gene encodes a member of the mucin protein family.
• Mucins are high molecular weight glycoproteins secreted by many epithelial tissues to form an insoluble mucous barrier.
• The C-terminus of this family member associates with the multifunctional docking site of the MET proto-oncogene and suppresses activation of some downstream MET signaling cascades.
• The protein features a mucin tandem repeat domain that varies between two and six copies in most individuals.
• Multiple variants encoding different isoforms have been found for this gene.
• A related pseudogene, which is also located on chromosome 3, has been identified.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD
• Positive Control:293T, A-549, DU145, LO2, U-251MG, HT-29, Mouse kidney, Mouse lung, Rat kidney
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.