This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex.
This complex is required for transcription of most RNA polymerase II-dependent genes.
The encoded protein plays a role in chromatin modification and in preinitiation complex assembly.
Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:PYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAP
Positive Control:K-562, A-549, mouse brain, rat kidney
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human MED25. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Recombinant fusion protein containing a sequence corresponding to aa30-200 of human MED25 (NP_112235.2).
