The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family.
This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade.
It phosphorylates and thus activates MAPK14/p38-MAPK.
This kinase can be activated by insulin, and is necessary for the expression of glucose transporter.
Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells.
The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis.
Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene.
Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:200 Immunofluorescence: 1:50-1:200 Optimal dilutions to be determined by the researcher.
AA Sequence:MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIA