The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family.
This kinase is known to play a critical role in mitogen growth factor signal transduction.
It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3.
The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases.
Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome.
The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax.
A pseudogene, which is located on chromosome 7, has been identified for this gene.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:100-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human MAP2K2 [KO Validated]. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB KO
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence within aa1-100 of human MAP2K2 (NP_109587.1).