This gene encodes a type I transmembrane protein and member of the immunoglobulin superfamily of cell adhesion molecules.
The encoded protein localizes to adherens junctions in pancreatic beta cells and regulates insulin secretion.
Autoantibodies against the encoded protein have been detected in serum from patients with type 1 diabetes.
This gene may also play a role in glomerular development and decreased expression of this gene has been observed in human glomerular diseases.
This gene and the related opposite-strand gene nephrin (GeneID: 527362) are regulated by a bidirectional promoter.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:1000-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:GPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAIT
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human KIRREL2. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa21-220 of human KIRREL2 (NP_954649.3).