The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains.
This family member functions in cytoskeleton formation by regulating actin polymerization.
This gene is a candidate tumor suppressor for renal cell carcinoma.
Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder.
A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia.
Alternative splicing of this gene results in multiple transcript variants.
A related pseudogene has been identified on chromosome 20.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:GNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGIN
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human KANK1. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide corresponding to a sequence within aa900-1000 of human KANK1 (NP_055973.2).
