The protein encoded by this gene is a cytokine receptor that specifically mediates the biological effects of interleukin 9 (IL9).
The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor, gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines.
The ligand binding of this receptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologic responses.
This gene is located at the pseudoautosomal regions of X and Y chromosomes.
Genetic studies suggested an association of this gene with the development of asthma.
Multiple pseudogenes on chromosome 9, 10, 16, and 18 have been described.
Alternatively spliced transcript variants have been found for this gene.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:100-1:200 Optimal dilutions to be determined by the researcher.
AA Sequence:PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPA
Positive Control:NIH/3T3, mouse thymus
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human IL9R. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence within aa50-150 of human IL9R (XP_011529456.1).