This receptor binds insulin-like growth factor with a high affinity.
It has tyrosine kinase activity.
The insulin-like growth factor I receptor plays a critical role in transformation events.
Cleavage of the precursor generates alpha and beta subunits.
It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.
Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human IGF1R. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa741-910 of human IGF1R (NP_000866.1).