84-5355-01　［取扱停止］HER2/ErbB2 [KO Validated] 100ul　530830

特徴

• This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases.
• This protein has no ligand binding domain of its own and therefore cannot bind growth factors.
• However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase.
• Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here.
• Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors.
• Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
• Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:100 Immunofluorescence: 1:50-1:100 Optimal dilutions to be determined by the researcher.
• AA Sequence:ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
• Positive Control:293T, HepG2, HeLa, mouse uterus
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.