84-5351-71　［取扱停止］FXYD1 200ul　530720

特徴

• This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids.
• The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator.
• Mouse FXYD5 has been termed RIC (Related to Ion Channel).
• FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.
• FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.
• Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane.
• The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase.
• It is thought to form an ion channel or regulate ion channel activity.
• Transcript variants with different 5' UTR sequences have been described in the literature.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.