This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins.
The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs.
It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation.
Defects in this gene are the cause of faciogenital dysplasia and X-linked mental retardation, syndromatic 16.
Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:100Immunofluorescence: 1:50-1:100Optimal dilutions to be determined by the researcher.
AA Sequence:LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS
Positive Control:U-87MG, BxPC-3, HepG2, U2OS
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human FGD1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IF IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to a sequence within aa700-800 of human FGD1 (NP_004454.2).