This gene encodes a member of the engulfment and cell motility family of GTPase-activating proteins that regulate Arf GTPase proteins.
Members of this family are defined by a conserved engulfment and cell motility domain.
In rat cochlea, the encoded protein is found in stereocilia, kinocilia and cuticular plate of developing hair cells suggesting a function for this protein in cochlear sensory cells.
An allelic variant of this family has been associated with autosomal recessive nonsyndromic deafness-88 in humans.
Alternative splicing results in multiple transcript variants.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:ATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFKDLTFTGESDLQSHSSEGVWLI
Positive Control:A-549, mouse brain, rat brain
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human ELMOD3. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa290-381 of human ELMOD3 (NP_001128493.1).