The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins.
It is a nuclear protein and functions as a transcriptional regulator.
The products of target genes it activates are required for differentitation and mitogenesis.
Studies suggest this is a cancer suppressor gene.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:1000Immunohistochemistry: 1:20-1:200 Immunofluorescence: 1:10-1:100 Immunoprecipitation: 1:20-1:50 Optimal dilutions to be determined by the researcher.
AA Sequence:MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVP
Positive Control:A-431, OVCAR3
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human EGR1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Recombinant fusion protein containing a sequence corresponding to aa1-250 of human EGR1 (NP_001955.1).
