Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds.
The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases.
According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues).
The protein encoded by this gene is activated by trypsin and acts on carboxypeptidase B substrates.
After thrombin activation, the mature protein downregulates fibrinolysis.
Polymorphisms have been described for this gene and its promoter region.
Alternate splicing results in multiple transcript variants.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:HSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKISKNTRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFA
Positive Control:Rat testis, Rat liver
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes CPB2. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Rt
Immunogen:Recombinant fusion protein corresponding to aa310-410 of human CPB2.