This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain.
Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors.
This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place.
Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.
The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy.
Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes.
Two protein isoforms are encoded by transcript variants of this gene.
Additional transcript variants have been described, but their full-length nature has not been determined.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:EKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRRKAASILSDTKNMEIINSTIETLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEIVNA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human CDY1B. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa60-320 of human CDY1B (NP_001003895.1).