84-5340-35　［取扱停止］CD81 100ul　530344

特徴

• The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family.
• Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains.
• The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
• This encoded protein is a cell surface glycoprotein that is known to complex with integrins.
• This protein appears to promote muscle cell fusion and support myotube maintenance.
• Also it may be involved in signal transduction.
• This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies.
• Two transcript variants encoding different isoforms have been found for this gene.
• Applications:Suitable for use in Western Blot and Immunohistochemistry.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:1000Immunohistochemistry: 1:50 - 1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVI
• Positive Control:Raji, U-87MG
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.