84-5340-07　［取扱停止］CD14 50ul　530335

特徴

• The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages.
• It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.
• Alternative splicing results in multiple transcript variants encoding the same protein.
• Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:200 Immunofluorescence: 1:50-1:200 Optimal dilutions to be determined by the researcher.
• AA Sequence:TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNP
• Positive Control:Mouse lung, mouse spleen, mouse kidney
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.