84-5339-69　CBFA2T3 200ul　530322

特徴

• This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression.
• The t(16;21)(q24;q22) translocation is one of the less common karyotypic abnormalities in acute myeloid leukemia.
• The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene.
• This gene is also a putative breast tumor suppressor.
• Alternative splicing results in transcript variants.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilutions:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.