BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release.
All the BAG proteins have an approximately 45aa BAG domain near the C terminus but differ markedly in their N-terminal regions.
The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region.
The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells.
All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
Applications:Suitable for use in Western Blot, Immunohistochemistry, Immunofluorescence and Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:100Immunofluorescence: 1:50-1:100Immunoprecipitation: 1:50-1:100Optimal dilutions to be determined by the researcher.
AA Sequence:PSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human BAG3. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IF IHC IP WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Recombinant fusion protein containing a sequence corresponding to aa380-575 of human BAG3 (NP_004272.2).
