84-5335-39　［取扱停止］AMOTL2 200ul　530179

特徴

• Angiomotin is a protein that binds angiostatin, a circulating inhibitor of the formation of new blood vessels (angiogenesis).
• Angiomotin mediates angiostatin inhibition of endothelial cell migration and tube formation in vitro.
• The protein encoded by this gene is related to angiomotin and is a member of the motin protein family.
• Alternative splicing results in multiple transcript variants of this gene.
• Applications:Suitable for use in Western Blot, Immunohistochemistry and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:50-1:100Immunofluorescence: 1:50-1:100Optimal dilutions to be determined by the researcher.
• AA Sequence:RQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI
• Positive Control:293T, U-251MG, HepG2, Mouse liver, Mouse brain
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.