84-5333-55　［取扱停止］ABCD4 50ul　530118

特徴

• The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters.
• ABC proteins transport various molecules across extra- and intra-cellular membranes.
• ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
• This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle.
• All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter.
• The function of this peroxisomal membrane protein is unknown.
• However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype.
• It may also play a role in the process of peroxisome biogenesis.
• Alternative splicing results in at least two different transcript variants, one which is protein-coding and one which is probably not protein-coding.
• [provided by RefSeq, Jul 2008]
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:DQFTCNLLYVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQLSSMASKLIISPFTLVYYTYQCFQSTGWLGPVSIFGYFILGTVVNKTLMGPIVMKLVHQEKLEGDFRFKHMQIRVNAEPAAFYRAGHVEHMRTDRRLQRLLQTQRELMSKELWLYIGINTFDYL
• Positive Control:MCF7
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.