The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters.
ABC proteins transport various molecules across extra- and intracellular membranes.
ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This protein is a member of the ABC1 subfamily.
Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes.
This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development.
Two transcript variants encoding different isoforms have been found for this gene.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:1000Optimal dilutions to be determined by the researcher.
AA Sequence:FGDGYMITVRTKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQSDNLEQQETEPPSALQSPLGCLLSLLRPRSAPTELRALVADEPEDLDTEDEGLISFEEERAQLSFNTDTLC
Positive Control:HeLa, Rat brain
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human ABCA2. Species Crossreactivity: mouse
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu Mo
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa2307-2466 of human ABCA2.