SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS. Labeled with Fluorescein isothiocyanate (FITC).
Specificity：Recognizes human SLC17A3. Species Crossreactivity: bovine and equine
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Bo Eq Hu
Immunogen：Synthetic peptide corresponding to a fragment of residues within the following region of human SLC17A3: FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS
