The WNT gene family consists of structurally related genes which encode secreted signaling proteins.
These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
WNT5B gene is a member of the WNT gene family.
WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein.
The WNT gene family consists of structurally related genes which encode secreted signaling proteins.
These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
This gene is a member of the WNT gene family.
It encodes a protein which shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein, respectively.
Alternative splicing of this gene generates 2 transcript variants.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human WNT5B.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT corresponding to the C-terminal of human WNT5B. Species sequence homology: bovine, canine, guinea pig, equine, mouse, porcine, rabbit and rat
