TOM1L1 is a probable adapter protein involved in signaling pathways.
It interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated.
It may promotes FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human TOM1L1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region of human TOM1L1: LNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPR. Species sequence homology: rabbit and rat
