The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM).
Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM.
Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:LVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKY
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human TIMP3. Species Crossreactivity: bovine, canine, guinea pig, equine, mouse, rabbit, rat and sheep
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Bo Ca Eq Gp Hu Mo Rb Rt Sh
Immunogen：Synthetic peptide corresponding to the middle region of human TIMP3
