It contains 3 ANK repeats and 1 protein kinase domain.
TEX14 is required for spermatogenesis and male fertility.
It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia.
It has no protein kinase activity.
Applications:Suitable for use in and Western Blot.
Other applications not tested.
Recommended Dilutions:Western Blot: 0.2-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Specificity：Recognizes human TEX14.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region at the middle region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKof human TEX14.
