This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain.
The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth.
Mutations in this gene are associated with forebrain defects.
Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X.
Alternate splicing results in multiple transcript variants.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human TDGF1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region: LRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSY, from the middle region of human TDGF1.
