Sfxn5 is a mitochondrial tricarboxylate carrier protein that has citrate transport activity.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：rat
Grade：Affinity Purified
Purity：Purified by affinity chromatography
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide
Specificity：Recognizes rat SFXN5. Species Sequence Homology: bovine, canine, guinea pig, equine, human, mouse, rabbit and zebrafish
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Rt
Immunogen：Synthetic peptide located within the following region: NEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTL of the N-terminal region of rat SFXN5.
