Scamp5 is required for the calcium-dependent exocytosis of signal sequence-containing cytokines such as CCL5.
It probably acts in cooperation with the SNARE machinery.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes mouse SCAMP5
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide located within the following region: VFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAA corresponding to the C-terminal of mouse SCAMP5. Species Sequence Homology: human, rat, bovine, canine guinea pig, equine, rabbit and zebrafish
