RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers.
It is involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
It plays an essential role in cleavage furrow formation.
It is required for the apical junction formation of keratinocyte cell-cell adhesion.
It may be an activator of PLCE1.
Activated by ARHGEF2, which promotes the exchange of GDP for GTP.
It is essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly.
The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex.
It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity.
In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity).
Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:rat
Grade:Affinity Purified
Purity:Purified by affinity chromatography
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide
Specificity:Recognizes rat RHOA.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Rt
Immunogen:Synthetic peptide located within the following region: AKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA of the C-terminal region of rat RHOA