This gene encodes a member of the paired box (PAX) family of transcription factors.
The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box.
Paired box transcription factors are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation.
This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation.
Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis.
This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas.
This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas.
Alternative splicing results in multiple transcript variants encoding different isoforms.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity:Recognizes human PAX5.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region directed towards the middle region of human PAX5: TGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN. Species sequence homology: bovine: 100%; canine: 100%; guinea pig: 100%; equine: 86%; mouse: 100%; rabbit: 100%; rat: 100%