The PAX5 gene is a member of the paired box (PAX) family of transcription factors.
The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box.
The PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation.
The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP) that is expressed at early, but not late stages of B-cell differentiation.
Its expression has also been detected in developing CNS and testis, therefore, PAX5 gene product may not only play an important role in B-cell differentiation, but also in neural development and spermatogenesis.
Applications:Suitable for use in Immunohistochemistry and Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human PAX5.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region directed towards the N-terminal of human PAX5: CVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWE. Species sequence homology: bovine: 100%; canine: 100%; guinea pig: 100%; equine: 100%; mouse: 100%; rabbit: 100%; rat: 100%; zebrafish: 100%
